PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo19G0027200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 124aa    MW: 12825.8 Da    PI: 9.7696
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo19G0027200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK70.22.9e-224994348
           RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                     ++++++d++k+F+ pi++AA  Lgvc +vLKriCR++G+ RWP+Rk
  Spipo19G0027200 49 SRLTFDDVAKHFNVPIAEAATALGVCSSVLKRICRENGVVRWPYRK 94
                     689******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.38134117IPR003035RWP-RK domain
PfamPF020429.6E-225195IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MTGMPPGPEM AKASATQLSP APPPSPPARL VSASGGGAAP TVSTAPNASR LTFDDVAKHF  60
NVPIAEAATA LGVCSSVLKR ICRENGVVRW PYRKFLAGKT VDDIKKDAAK EKSKEFAELS  120
KCC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857943.13e-32PREDICTED: uncharacterized protein LOC18447794
TrEMBLU5DAZ83e-32U5DAZ8_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr10P15240_0014e-29(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-13RWP-RK domain-containing protein